Ferric-Chelate Reductase 1 Like (FRRS1L) (Middle Region) Antikörper
-
- Target Alle Ferric-Chelate Reductase 1 Like (FRRS1L) Antikörper anzeigen
- Ferric-Chelate Reductase 1 Like (FRRS1L)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- C9 ORF4 antibody was raised against the middle region of C9 rf4
- Aufreinigung
- Affinity purified
- Immunogen
- C9 ORF4 antibody was raised using the middle region of C9 rf4 corresponding to a region with amino acids HDDNGRVRIQHFYNVGQWAKEIQRNPARDEEGVFENNRVTCRFKRPVNVP
- Top Product
- Discover our top product FRRS1L Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C9ORF4 Blocking Peptide, catalog no. 33R-3707, is also available for use as a blocking control in assays to test for specificity of this C9ORF4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Ferric-Chelate Reductase 1 Like (FRRS1L)
- Andere Bezeichnung
- C9ORF4 (FRRS1L Produkte)
- Hintergrund
- The function of C9orf4 protein has not been widely studied, and is yet to be fully elucidated.
- Molekulargewicht
- 37 kDa (MW of target protein)
-