ST6GALNAC6 Antikörper (ST6 (Alpha-N-Acetyl-Neuraminyl-2,3-beta-Galactosyl-1,3)-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 6) (C-Term)

Details for Product anti-ST6GALNAC6 Antibody No. ABIN635440
Antigen
Epitop
C-Term
4
4
2
2
1
1
Reaktivität
Human, Maus, Ratte (Rattus)
17
5
5
4
4
4
4
3
2
1
1
Wirt
Kaninchen
11
6
Klonalität
Polyklonal
Konjugat
Dieser ST6GALNAC6 Antikörper ist unkonjugiert
1
1
1
Applikation
Western Blotting (WB)
13
7
1
Optionen
Immunogen ST6 GALNAC6 antibody was raised using the C terminal of ST6 ALNAC6 corresponding to a region with amino acids YHYYEPKGPDECVTYIQNEHSRKGNHHRFITEKRVFSSWAQLYGITFSHP
Spezifität ST6 GALNAC6 antibody was raised against the C terminal of ST6 ALNAC6
Reinigung Affinity purified
Antigen
Andere Bezeichnung ST6GALNAC6 (ST6GALNAC6 Antibody Abstract)
Hintergrund ST6GALNAC6 belongs to a family of sialyltransferases that modify proteins and ceramides on the cell surface to alter cell-cell or cell-extracellular matrix interactions.ST6GALNAC6 belongs to a family of sialyltransferases that modify proteins and ceramides on the cell surface to alter cell-cell or cell-extracellular matrix interactions.
Molekulargewicht 38 kDa (MW of target protein)
Applikations-hinweise WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

ST6GALNAC6 Blocking Peptide, catalog no. 33R-10129, is also available for use as a blocking control in assays to test for specificity of this ST6GALNAC6 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 ALNAC6 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-ST6 (Alpha-N-Acetyl-Neuraminyl-2,3-beta-Galactosyl-1,3)-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 6 (ST6GALNAC6) (C-Term) antibody (ABIN635440) ST6GALNAC6 antibody used at 0.5 ug/ml to detect target protein.