SYNGR4 Antikörper (Synaptogyrin 4) (N-Term)

Details for Product anti-SYNGR4 Antibody No. ABIN635439
Antigen
Epitop
N-Term
16
Reaktivität
Human
37
25
23
2
2
1
1
1
Wirt
Kaninchen
30
7
Klonalität
Polyklonal
Konjugat
Dieser SYNGR4 Antikörper ist unkonjugiert
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
25
18
13
5
5
2
1
1
Optionen
Immunogen Synaptogyrin 4 antibody was raised using the N terminal of SYNGR4 corresponding to a region with amino acids MHIPKSLQELANSEAVQFLRRPKTITRVFEGVFSLIVFSSLLTDGYQNKM
Spezifität Synaptogyrin 4 antibody was raised against the N terminal of SYNGR4
Reinigung Affinity purified
Antigen
Andere Bezeichnung Synaptogyrin 4 (SYNGR4 Antibody Abstract)
Hintergrund SYNGR4 is an integral membrane protein. The gene belongs to the synaptogyrin gene family. Like other members of the family the protein contains four transmembrane regions. The exact function of this protein is unclear.
Molekulargewicht 26 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

Synaptogyrin 4 Blocking Peptide, catalog no. 33R-6093, is also available for use as a blocking control in assays to test for specificity of this Synaptogyrin 4 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYNGR4 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Synaptogyrin 4 (SYNGR4) (N-Term) antibody (ABIN635439) Synaptogyrin 4 antibody used at 1 ug/ml to detect target protein.