SYNGR4 Antikörper (N-Term)

Produktnummer ABIN635439

Produktdetails anti-SYNGR4 Antikörper

Target: SYNGR4 (Synaptogyrin 4 (SYNGR4))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SYNGR4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Synaptogyrin 4 antibody was raised against the N terminal of SYNGR4

Aufreinigung: Affinity purified

Immunogen: Synaptogyrin 4 antibody was raised using the N terminal of SYNGR4 corresponding to a region with amino acids MHIPKSLQELANSEAVQFLRRPKTITRVFEGVFSLIVFSSLLTDGYQNKM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Synaptogyrin 4 Blocking Peptide, catalog no. 33R-6093, is also available for use as a blocking control in assays to test for specificity of this Synaptogyrin 4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYNGR4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SYNGR4

Target: SYNGR4 (Synaptogyrin 4 (SYNGR4))

Andere Bezeichnung: Synaptogyrin 4 (SYNGR4 Produkte)

Hintergrund: SYNGR4 is an integral membrane protein. The gene belongs to the synaptogyrin gene family. Like other members of the family the protein contains four transmembrane regions. The exact function of this protein is unclear.

Molekulargewicht: 26 kDa (MW of target protein)