RER1 Antikörper (RER1 Retention in Endoplasmic Reticulum 1 Homolog (S. Cerevisiae))

Details for Product anti-RER1 Antibody No. ABIN635434
Antigen
Reaktivität
Human, Maus, Ratte (Rattus)
14
3
3
2
2
2
2
2
2
1
1
1
1
Wirt
Kaninchen
7
7
Klonalität
Polyklonal
Konjugat
Dieser RER1 Antikörper ist unkonjugiert
2
2
2
1
1
1
Applikation
Western Blotting (WB)
12
3
3
1
Optionen
Immunogen RER1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GIYHLNLFIAFLSPKVDPSLMEDSDDGPSLPTKQNEEFRPFIRRLPEFKF
Reinigung Affinity purified
Antigen
Andere Bezeichnung RER1 (RER1 Antibody Abstract)
Hintergrund RER1 is involved in the retrieval of endoplasmic reticulum membrane proteins from the early Golgi compartment.
Molekulargewicht 23 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

RER1 Blocking Peptide, catalog no. 33R-3349, is also available for use as a blocking control in assays to test for specificity of this RER1 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RER1 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-RER1 Retention in Endoplasmic Reticulum 1 Homolog (S. Cerevisiae) (RER1) antibody (ABIN635434) RER1 antibody used at 1 ug/ml to detect target protein.