RER1 Antikörper

Produktnummer ABIN635434

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch RER1 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für RER1 Antikörper (ABIN635434)

Target: RER1 (RER1 Retention in Endoplasmic Reticulum 1 Homolog (RER1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RER1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RER1 Antikörper

Aufreinigung: Affinity purified

Immunogen: RER1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GIYHLNLFIAFLSPKVDPSLMEDSDDGPSLPTKQNEEFRPFIRRLPEFKF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RER1 Blocking Peptide, (ABIN938735), is also available for use as a blocking control in assays to test for specificity of this RER1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RER1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RER1

Target: RER1 (RER1 Retention in Endoplasmic Reticulum 1 Homolog (RER1))

Andere Bezeichnung: RER1

Hintergrund: RER1 is involved in the retrieval of endoplasmic reticulum membrane proteins from the early Golgi compartment.

Molekulargewicht: 23 kDa (MW of target protein)