Golgin B1 (GOLGB1) (N-Term) Antikörper
-
- Target Alle Golgin B1 (GOLGB1) Antikörper anzeigen
- Golgin B1 (GOLGB1)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GOLGB1 antibody was raised against the N terminal of GOLGB1
- Aufreinigung
- Affinity purified
- Immunogen
- GOLGB1 antibody was raised using the N terminal of GOLGB1 corresponding to a region with amino acids NKYIEEMKAQGGTVLPTEPQSEEQLSKHDKSSTEEEMEIEKIKHKLQEKE
- Top Product
- Discover our top product GOLGB1 Primärantikörper
-
anti-Golgin B1 (GOLGB1) (AA 751-850) antibody
GOLGB1 Reaktivität: Human, Maus, Ratte WB, ELISA, FACS, IF (cc), IF (p), ICC, IHC (fro), IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Golgin B1 (GOLGB1) (AA 1-427) antibodyGOLGB1 Reaktivität: Maus, Ratte WB, IHC, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Golgin B1 (GOLGB1) antibodyGOLGB1 Reaktivität: Maus, Ratte WB, IHC, ICC Wirt: Meerschweinchen Polyclonal unconjugated
anti-Golgin B1 (GOLGB1) (AA 1764-1869) antibodyGOLGB1 Reaktivität: Human ELISA, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Golgin B1 (GOLGB1) (AA 3-91) antibodyGOLGB1 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 6D4 unconjugated
anti-Golgin B1 (GOLGB1) (AA 751-850) antibody (AbBy Fluor® 488)GOLGB1 Reaktivität: Human, Maus, Ratte WB, FACS, IF (cc), IF (p) Wirt: Kaninchen Polyclonal AbBy Fluor® 488
anti-Golgin B1 (GOLGB1) antibodyGOLGB1 Reaktivität: Human DB Wirt: Maus Monoclonal 2388C3a unconjugated
anti-Golgin B1 (GOLGB1) (N-Term) antibodyGOLGB1 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Pferd, Schwein, Kaninchen WB, IHC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GOLGB1 Blocking Peptide, catalog no. 33R-6750, is also available for use as a blocking control in assays to test for specificity of this GOLGB1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GOLGB1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Golgin B1 (GOLGB1)
- Andere Bezeichnung
- GOLGB1 (GOLGB1 Produkte)
- Hintergrund
- GOLGB1 may participate in forming intercisternal cross-bridges of the Golgi complex.
- Molekulargewicht
- 376 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interaktom
-
