Golgin B1 (GOLGB1) (N-Term) Antikörper

Produktnummer ABIN635428

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für Golgin B1 (GOLGB1) (N-Term) Antikörper (ABIN635428)

Target: Golgin B1 (GOLGB1)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails

Bindungsspezifität: N-Term

Spezifität: GOLGB1 antibody was raised against the N terminal of GOLGB1

Aufreinigung: Affinity purified

Immunogen: GOLGB1 antibody was raised using the N terminal of GOLGB1 corresponding to a region with amino acids NKYIEEMKAQGGTVLPTEPQSEEQLSKHDKSSTEEEMEIEKIKHKLQEKE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GOLGB1 Blocking Peptide, (ABIN5613819), is also available for use as a blocking control in assays to test for specificity of this GOLGB1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GOLGB1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: Golgin B1 (GOLGB1)

Andere Bezeichnung: GOLGB1

Hintergrund: GOLGB1 may participate in forming intercisternal cross-bridges of the Golgi complex.

Molekulargewicht: 376 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom