Carbohydrate (N-Acetylglucosamine-6-O) Sulfotransferase 2 (CHST2) Antikörper

Details zu Produkt Nr. ABIN635427
Antigen
Reaktivität
Human, Maus, Ratte (Rattus)
72
20
6
4
4
4
4
4
2
2
1
Wirt
Kaninchen
69
2
1
Klonalität
Polyklonal
Konjugat
Unkonjugiert
5
4
4
4
4
4
1
1
1
1
1
1
Applikation
Western Blotting (WB)
66
44
18
6
2
2
1
1
Optionen
Immunogen CHST2 antibody was raised using a synthetic peptide corresponding to a region with amino acids NAWRTALTFQQIKQVEEFCYQPMAVLGYERVNSPEEVKDLSKTLLRKPRL
Reinigung Affinity purified
Antigen
Andere Bezeichnung CHST2 (CHST2 Antibody Abstract)
Hintergrund N-acetylglucosamine-6-O-sulfotransferases, such as CHST2, catalyze the transfer of sulfate from 3-prime-phosphoadenosine 5-prime-phosphosulfate (PAPS) to position 6 of a nonreducing N-acetylglucosamine (GlcNAc) residue.
Molekulargewicht 58 kDa (MW of target protein)
Pathways Glycosaminoglycan Metabolic Process
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

CHST2 Blocking Peptide, catalog no. 33R-6649, is also available for use as a blocking control in assays to test for specificity of this CHST2 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHST2 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Carbohydrate (N-Acetylglucosamine-6-O) Sulfotransferase 2 (CHST2) antibody (ABIN635427) CHST2 antibody used at 1 ug/ml to detect target protein.