DEGS1 Antikörper

Produktnummer ABIN635423

Der Kaninchen Polyklonal anti-DEGS1 Antikörper wird verwendet zum Nachweis von DEGS1 in Proben von Human, Maus und Ratte. Er wurde validiert für WB.

Kurzübersicht für DEGS1 Antikörper (ABIN635423)

Target: DEGS1 (Sphingolipid Delta(4)-Desaturase DES1 (DEGS1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DEGS1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DEGS1 Antikörper

Aufreinigung: Affinity purified

Immunogen: DEGS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPDPNLIWIIIMMV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DEGS1 Blocking Peptide, (ABIN938970), is also available for use as a blocking control in assays to test for specificity of this DEGS1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DEGS1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DEGS1

Target: DEGS1 (Sphingolipid Delta(4)-Desaturase DES1 (DEGS1))

Andere Bezeichnung: DEGS1

Hintergrund: DEGS1 is a member of the membrane fatty acid desaturase family which is responsible for inserting double bonds into specific positions in fatty acids. This protein contains three His-containing consensus motifs that are characteristic of a group of membrane fatty acid desaturases. It is predicted to be a multiple membrane-spanning protein localized to the endoplasmic reticulum. Overexpression of this protein inhibited biosynthesis of the EGF receptor, suggesting a possible role of a fatty acid desaturase in regulating biosynthetic processing of the EGF receptor.

Molekulargewicht: 38 kDa (MW of target protein)