Integrin alpha-8 / ITGA8 (N-Term) Antikörper

Details zu Produkt Nr. ABIN635422
Antigen
Epitop
N-Term
12
10
8
4
3
2
2
1
1
1
1
Reaktivität
Human
45
12
7
2
2
2
1
1
1
1
1
Wirt
Kaninchen
37
8
4
Klonalität
Polyklonal
Konjugat
Unkonjugiert
5
4
4
2
2
2
1
1
1
1
1
1
Applikation
Western Blotting (WB)
39
22
19
9
4
3
2
1
Optionen
Immunogen Integrin Alpha 8 antibody was raised using the N terminal of ITGA8 corresponding to a region with amino acids GEKQTEVAPASYDDSYLGYSVAAGEFTGDSQQELVAGIPRGAQNFGYVSI
Spezifität Integrin Alpha 8 antibody was raised against the N terminal of ITGA8
Reinigung Affinity purified
Antigen
Andere Bezeichnung Integrin alpha 8
Hintergrund Integrin alpha-8/beta-1 functions in the genesis of kidney and probably of other organs by regulating the recruitment of mesenchymal cells into epithelial structures.
Molekulargewicht 117 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

Integrin Alpha 8 Blocking Peptide, catalog no. 33R-3233, is also available for use as a blocking control in assays to test for specificity of this Integrin Alpha 8 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ITGA8 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Integrin alpha-8 / ITGA8 (N-Term) antibody (ABIN635422) Integrin Alpha 8 antibody used at 1 ug/ml to detect target protein.