KLRC3 Antikörper (N-Term)
-
- Target Alle KLRC3 Antikörper anzeigen
- KLRC3 (Killer Cell Lectin-Like Receptor Subfamily C, Member 3 (KLRC3))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KLRC3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- KLRC3 antibody was raised against the N terminal of KLRC3
- Aufreinigung
- Affinity purified
- Immunogen
- KLRC3 antibody was raised using the N terminal of KLRC3 corresponding to a region with amino acids MSKQRGTFSEVSLAQDPKWQQRKPKGNKSSISGTEQEIFQVELNLQNASL
- Top Product
- Discover our top product KLRC3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KLRC3 Blocking Peptide, catalog no. 33R-6452, is also available for use as a blocking control in assays to test for specificity of this KLRC3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLRC3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KLRC3 (Killer Cell Lectin-Like Receptor Subfamily C, Member 3 (KLRC3))
- Andere Bezeichnung
- KLRC3 (KLRC3 Produkte)
- Synonyme
- Klrc2 antikoerper, Nkg2e antikoerper, KLRC2 antikoerper, NKG2-C antikoerper, NKG2-E antikoerper, NKG2E antikoerper, killer cell lectin-like receptor subfamily C, member 3 antikoerper, killer cell lectin like receptor C3 antikoerper, Klrc3 antikoerper, KLRC3 antikoerper
- Hintergrund
- Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity.
- Molekulargewicht
- 27 kDa (MW of target protein)
-