Killer Cell Lectin-Like Receptor Subfamily C, Member 3 (KLRC3) (N-Term) Antikörper

Details zu Produkt Nr. ABIN635416
Antigen
Epitop
N-Term
4
3
Reaktivität
Human
15
1
Wirt
Kaninchen
10
5
Klonalität
Polyklonal
Konjugat
Unkonjugiert
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
10
6
1
1
Optionen
Immunogen KLRC3 antibody was raised using the N terminal of KLRC3 corresponding to a region with amino acids MSKQRGTFSEVSLAQDPKWQQRKPKGNKSSISGTEQEIFQVELNLQNASL
Spezifität KLRC3 antibody was raised against the N terminal of KLRC3
Reinigung Affinity purified
Antigen
Andere Bezeichnung KLRC3 (KLRC3 Antibody Abstract)
Hintergrund Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity.
Molekulargewicht 27 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

KLRC3 Blocking Peptide, catalog no. 33R-6452, is also available for use as a blocking control in assays to test for specificity of this KLRC3 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLRC3 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Killer Cell Lectin-Like Receptor Subfamily C, Member 3 (KLRC3) (N-Term) antibody (ABIN635416) KLRC3 antibody used at 1 ug/ml to detect target protein.