TMTC4 Antikörper (N-Term)

Produktnummer ABIN635412

Dieses Anti-TMTC4-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von TMTC4 in WB. Geeignet für Human und Ratte.

Kurzübersicht für TMTC4 Antikörper (N-Term) (ABIN635412)

Target: TMTC4 (Transmembrane and Tetratricopeptide Repeat Containing 4 (TMTC4))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMTC4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TMTC4 Antikörper

Bindungsspezifität: N-Term

Spezifität: TMTC4 antibody was raised against the N terminal of TMTC4

Aufreinigung: Affinity purified

Immunogen: TMTC4 antibody was raised using the N terminal of TMTC4 corresponding to a region with amino acids NKDLQAETPLGDLWHHDFWGSRLSSNTSHKSYRPLTVLTFRINYYLSGGF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMTC4 Blocking Peptide, (ABIN5616702), is also available for use as a blocking control in assays to test for specificity of this TMTC4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMTC4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMTC4

Target: TMTC4 (Transmembrane and Tetratricopeptide Repeat Containing 4 (TMTC4))

Andere Bezeichnung: TMTC4

Hintergrund: TMTC4 belongs to the TMTC family. Its exact function remains unknown.

Molekulargewicht: 85 kDa (MW of target protein)