Yip1 Interacting Factor Homolog B (S. Cerevisiae) (YIF1B) Antikörper

Details zu Produkt Nr. ABIN635410
Antigen
Reaktivität
Human, Maus, Ratte (Rattus)
25
4
3
2
2
2
2
2
1
1
1
Wirt
Kaninchen
25
Klonalität
Polyklonal
Konjugat
Unkonjugiert
3
3
3
2
2
2
Applikation
Western Blotting (WB)
22
19
16
3
1
1
Optionen
Immunogen YIF1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids LGTQDRFSPDLLGLQASSALAWLTLEVLAILLSLYLVTVNTDLTTIDLVA
Reinigung Affinity purified
Antigen
Andere Bezeichnung YIF1B
Hintergrund YIF1B belongs to the YIF1 family. It is a multi-pass membrane protein. The functions of YIF1B remain unknown.
Molekulargewicht 31 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

YIF1B Blocking Peptide, catalog no. 33R-4998, is also available for use as a blocking control in assays to test for specificity of this YIF1B antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of YIF0 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Yip1 Interacting Factor Homolog B (S. Cerevisiae) (YIF1B) antibody (ABIN635410) YIF1B antibody used at 1 ug/ml to detect target protein.