YIF1B Antikörper

Produktnummer ABIN635410

Produktdetails anti-YIF1B Antikörper

Target: YIF1B (Yip1 Interacting Factor Homolog B (YIF1B))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser YIF1B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: YIF1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids LGTQDRFSPDLLGLQASSALAWLTLEVLAILLSLYLVTVNTDLTTIDLVA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

YIF1B Blocking Peptide, catalog no. 33R-4998, is also available for use as a blocking control in assays to test for specificity of this YIF1B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of YIF0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu YIF1B

Target: YIF1B (Yip1 Interacting Factor Homolog B (YIF1B))

Andere Bezeichnung: YIF1B (YIF1B Produkte)

Synonyme: FinGER8 antikoerper, MGC83008 antikoerper, 9430029K10Rik antikoerper, Yip1b antikoerper, zgc:103562 antikoerper, finger8 antikoerper, MGC76182 antikoerper, yif1b antikoerper, Yip1 interacting factor homolog B, membrane trafficking protein S homeolog antikoerper, Yip1 interacting factor homolog B (S. cerevisiae) antikoerper, Yip1 interacting factor homolog B, membrane trafficking protein antikoerper, protein YIF1B antikoerper, Yip1 interacting factor homolog B, membrane trafficking protein L homeolog antikoerper, yif1b.S antikoerper, Yif1b antikoerper, YIF1B antikoerper, yif1b antikoerper, LOC100380764 antikoerper, yif1b.L antikoerper

Hintergrund: YIF1B belongs to the YIF1 family. It is a multi-pass membrane protein. The functions of YIF1B remain unknown.

Molekulargewicht: 31 kDa (MW of target protein)