Chromosome 1 Open Reading Frame 151 (C1orf151) (Middle Region) Antikörper

Details zu Produkt Nr. ABIN635405
Antigen
Epitop
Middle Region
1
1
1
Reaktivität
Human, Maus
7
7
4
2
2
2
1
1
Wirt
Kaninchen
7
1
Klonalität
Polyklonal
Konjugat
Unkonjugiert
1
1
Applikation
Western Blotting (WB)
5
3
1
1
1
Optionen
Immunogen C1 ORF151 antibody was raised using the middle region of C1 rf151 corresponding to a region with amino acids IVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQEQ
Spezifität C1 ORF151 antibody was raised against the middle region of C1 rf151
Reinigung Affinity purified
Antigen
Andere Bezeichnung C1ORF151 (C1orf151 Antibody Abstract)
Hintergrund The function of C1orf151 protein has not been widely studied, and is yet to be fully elucidated.
Molekulargewicht 9 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

C1ORF151 Blocking Peptide, catalog no. 33R-4197, is also available for use as a blocking control in assays to test for specificity of this C1ORF151 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF151 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Chromosome 1 Open Reading Frame 151 (C1orf151) (Middle Region) antibody (ABIN635405) C1ORF151 antibody used at 1 ug/ml to detect target protein.