PLD3 Antikörper (N-Term)

Produktnummer ABIN635404

Produktdetails anti-PLD3 Antikörper

Target: PLD3 (Phospholipase D family member 3 (PLD3))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PLD3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PLD3 antibody was raised against the N terminal of PLD3

Aufreinigung: Affinity purified

Immunogen: PLD3 antibody was raised using the N terminal of PLD3 corresponding to a region with amino acids WVLLVLILAVVGFGALMTQLFLWEYGDLHLFGPNQRPAPCYDPCEAVLVE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PLD3 Blocking Peptide, catalog no. 33R-10033, is also available for use as a blocking control in assays to test for specificity of this PLD3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLD3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PLD3

Target: PLD3 (Phospholipase D family member 3 (PLD3))

Andere Bezeichnung: PLD3 (PLD3 Produkte)

Synonyme: DDBDRAFT_0204850 antikoerper, DDBDRAFT_0231505 antikoerper, DDB_0204850 antikoerper, DDB_0231505 antikoerper, DDBDRAFT_0187542 antikoerper, DDBDRAFT_0220113 antikoerper, DDB_0187542 antikoerper, DDB_0220113 antikoerper, HU-K4 antikoerper, HUK4 antikoerper, Sam-9 antikoerper, phospholipase D3 antikoerper, phospholipase D family member 3 antikoerper, phospholipase D family, member 3 antikoerper, CpipJ_CPIJ017227 antikoerper, pldZ antikoerper, pldY antikoerper, DICPUDRAFT_30308 antikoerper, PLD3 antikoerper, Pld3 antikoerper

Hintergrund: PLD3 is a ingle-pass type II membrane protein. It belongs to the phospholipase D family. PLD3 contains 2 PLD phosphodiesterase domains. The exact function of PLD3 remains unknown.

Molekulargewicht: 55 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom