Telefon:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@antikoerper-online.de

PLD3 Antikörper (N-Term)

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch PLD3 in WB. Er zeigt eine Reaktivität gegenüber Human und Maus.
Produktnummer ABIN635404

Kurzübersicht für PLD3 Antikörper (N-Term) (ABIN635404)

Target

Alle PLD3 Antikörper anzeigen
PLD3 (Phospholipase D family member 3 (PLD3))

Reaktivität

  • 18
  • 17
  • 7
  • 3
  • 3
  • 3
  • 3
  • 3
  • 1
  • 1
  • 1
  • 1
Human, Maus

Wirt

  • 25
Kaninchen

Klonalität

  • 25
Polyklonal

Konjugat

  • 16
  • 3
  • 2
  • 2
  • 1
  • 1
Dieser PLD3 Antikörper ist unkonjugiert

Applikation

  • 17
  • 17
  • 5
  • 2
  • 1
  • 1
Western Blotting (WB)
  • Bindungsspezifität

    • 9
    • 5
    • 4
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    N-Term

    Spezifität

    PLD3 antibody was raised against the N terminal of PLD3

    Aufreinigung

    Affinity purified

    Immunogen

    PLD3 antibody was raised using the N terminal of PLD3 corresponding to a region with amino acids WVLLVLILAVVGFGALMTQLFLWEYGDLHLFGPNQRPAPCYDPCEAVLVE
  • Applikationshinweise

    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.

    Kommentare

    PLD3 Blocking Peptide, (ABIN935988), is also available for use as a blocking control in assays to test for specificity of this PLD3 antibody

    Beschränkungen

    Nur für Forschungszwecke einsetzbar
  • Format

    Lyophilized

    Rekonstitution

    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLD3 antibody in PBS

    Konzentration

    Lot specific

    Buffer

    PBS

    Handhabung

    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.

    Lagerung

    4 °C/-20 °C

    Informationen zur Lagerung

    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target

    PLD3 (Phospholipase D family member 3 (PLD3))

    Andere Bezeichnung

    PLD3

    Hintergrund

    PLD3 is a ingle-pass type II membrane protein. It belongs to the phospholipase D family. PLD3 contains 2 PLD phosphodiesterase domains. The exact function of PLD3 remains unknown.

    Molekulargewicht

    55 kDa (MW of target protein)

    Pathways

    SARS-CoV-2 Protein Interaktom
Sie sind hier:
Chat with us!