C20orf30 Antikörper (C-Term)

Produktnummer ABIN635395

Produktdetails anti-C20orf30 Antikörper

Target: C20orf30 (Chromosome 20 Open Reading Frame 30 (C20orf30))

Bindungsspezifität: C-Term

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C20orf30 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C20 ORF30 antibody was raised against the C terminal Of C20 rf30

Aufreinigung: Affinity purified

Immunogen: C20 ORF30 antibody was raised using the C terminal Of C20 rf30 corresponding to a region with amino acids KGGADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRGYSYDDIPDFDD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C20ORF30 Blocking Peptide, catalog no. 33R-4391, is also available for use as a blocking control in assays to test for specificity of this C20ORF30 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF30 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C20orf30

Target: C20orf30 (Chromosome 20 Open Reading Frame 30 (C20orf30))

Andere Bezeichnung: C20ORF30 (C20orf30 Produkte)

Synonyme: MGC89669 antikoerper, C20orf30 antikoerper, TMEM230 antikoerper, c20orf30 antikoerper, HSPC274 antikoerper, dJ1116H23.2.1 antikoerper, C13H20orf30 antikoerper, RGD1307399 antikoerper, 5730494N06Rik antikoerper, AA407821 antikoerper, transmembrane protein 230 antikoerper, transmembrane protein 230 L homeolog antikoerper, tmem230 antikoerper, TMEM230 antikoerper, tmem230.L antikoerper, Tmem230 antikoerper

Hintergrund: The function of C20orf30 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 13 kDa (MW of target protein)