C20orf30 Antikörper (C-Term)

Produktnummer ABIN635395

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch C20orf30 in WB. Er zeigt eine Reaktivität gegenüber Human, Ratte und Maus.

Kurzübersicht für C20orf30 Antikörper (C-Term) (ABIN635395)

Target: C20orf30 (Chromosome 20 Open Reading Frame 30 (C20orf30))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C20orf30 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-C20orf30 Antikörper

Bindungsspezifität: C-Term

Spezifität: C20 ORF30 antibody was raised against the C terminal Of C20 rf30

Aufreinigung: Affinity purified

Immunogen: C20 ORF30 antibody was raised using the C terminal Of C20 rf30 corresponding to a region with amino acids KGGADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRGYSYDDIPDFDD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C20ORF30 Blocking Peptide, (ABIN939777), is also available for use as a blocking control in assays to test for specificity of this C20ORF30 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF30 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C20orf30

Target: C20orf30 (Chromosome 20 Open Reading Frame 30 (C20orf30))

Andere Bezeichnung: C20ORF30

Hintergrund: The function of C20orf30 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 13 kDa (MW of target protein)