ITPRIPL1 Antikörper (Inositol 1,4,5-Triphosphate Receptor Interacting Protein-Like 1) (C-Term)

Details for Product anti-ITPRIPL1 Antibody No. ABIN635394
Antigen
Epitop
C-Term
10
9
7
4
1
Reaktivität
Human
25
3
2
2
2
2
1
Wirt
Kaninchen
25
Klonalität
Polyklonal
Konjugat
Dieser ITPRIPL1 Antikörper ist unkonjugiert
2
2
2
2
2
2
Applikation
Western Blotting (WB)
25
16
Optionen
Immunogen KIAA1754 L antibody was raised using the C terminal of KIAA1754 corresponding to a region with amino acids IPIPKTFRNAEPVNLFQHLVLNPKAHSQAVEEFQNLLTQVKTLPHAPLAA
Spezifität KIAA1754 L antibody was raised against the C terminal of KIAA1754
Reinigung Affinity purified
Antigen
Andere Bezeichnung KIAA1754L
Hintergrund The function of KIAA1754L protein is not widely studied, and is yet to be elucidated fully.
Molekulargewicht 63 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

KIAA1754L Blocking Peptide, catalog no. 33R-4091, is also available for use as a blocking control in assays to test for specificity of this KIAA1754L antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA1750 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Inositol 1,4,5-Triphosphate Receptor Interacting Protein-Like 1 (ITPRIPL1) (C-Term) antibody (ABIN635394) KIAA1754L antibody used at 1 ug/ml to detect target protein.