NIPA2 Antikörper (Non Imprinted in Prader-Willi/Angelman Syndrome 2 Homolog (Human)) (Middle Region)

Details for Product anti-NIPA2 Antibody No. ABIN635392
Antigen
Epitop
Middle Region
1
1
Reaktivität
Human
3
2
2
2
2
2
2
2
1
1
1
Wirt
Kaninchen
3
Klonalität
Polyklonal
Applikation
Western Blotting (WB)
3
1
1
Optionen
Immunogen NIPA2 antibody was raised using the middle region of NIPA2 corresponding to a region with amino acids VYITICSVIGAFSVSCVKGLGIAIKELFAGKPVLRHPLAWILLLSLIVCV
Spezifität NIPA2 antibody was raised against the middle region of NIPA2
Reinigung Affinity purified
Antigen
Andere Bezeichnung NIPA2 (NIPA2 Antibody Abstract)
Hintergrund NIPA2 belongs to the NIPA family. It is a multi-pass membrane protein. The function of the NIPA2 protein remains unknown.
Molekulargewicht 39 kDa (MW of target protein)
Pathways Regulation of Actin Filament Polymerization
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

NIPA2 Blocking Peptide, catalog no. 33R-9920, is also available for use as a blocking control in assays to test for specificity of this NIPA2 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NIPA2 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Non Imprinted in Prader-Willi/Angelman Syndrome 2 Homolog (Human) (NIPA2) (Middle Region) antibody (ABIN635392) NIPA2 antibody used at 1 ug/ml to detect target protein.