NIPA2 Antikörper (Middle Region)

Produktnummer ABIN635392

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch NIPA2 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für NIPA2 Antikörper (Middle Region) (ABIN635392)

Target: NIPA2 (Non Imprinted in Prader-Willi/Angelman Syndrome 2 (NIPA2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NIPA2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-NIPA2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: NIPA2 antibody was raised against the middle region of NIPA2

Aufreinigung: Affinity purified

Immunogen: NIPA2 antibody was raised using the middle region of NIPA2 corresponding to a region with amino acids VYITICSVIGAFSVSCVKGLGIAIKELFAGKPVLRHPLAWILLLSLIVCV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NIPA2 Blocking Peptide, catalog no. 33R-9920, is also available for use as a blocking control in assays to test for specificity of this NIPA2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NIPA2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NIPA2

Target: NIPA2 (Non Imprinted in Prader-Willi/Angelman Syndrome 2 (NIPA2))

Andere Bezeichnung: NIPA2

Hintergrund: NIPA2 belongs to the NIPA family. It is a multi-pass membrane protein. The function of the NIPA2 protein remains unknown.

Molekulargewicht: 39 kDa (MW of target protein)

Pathways: Regulation of Actin Filament Polymerization