GP2 Antikörper (Glycoprotein 2 (Zymogen Granule Membrane))

Details for Product anti-GP2 Antibody No. ABIN635391
Antigen
Reaktivität
Human
93
9
5
1
1
1
Wirt
Kaninchen
51
51
Klonalität
Polyklonal
Konjugat
Dieser GP2 Antikörper ist unkonjugiert
5
3
3
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
Applikation
Western Blotting (WB)
52
52
40
40
31
28
20
16
8
4
1
1
1
Optionen
Immunogen Glycoprotein 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SLQAALQPIVSSLNVSVDGNGEFIVRMALFQDQNYTNPYEGDAVELSVES
Reinigung Affinity purified
Antigen
Andere Bezeichnung Glycoprotein 2
Hintergrund GP2 is component of pancreatic secretory (zymogen) granule. The exact function of GP2 remains unknown.
Molekulargewicht 43 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

Glycoprotein 2 Blocking Peptide, catalog no. 33R-8616, is also available for use as a blocking control in assays to test for specificity of this Glycoprotein 2 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GP2 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Glycoprotein 2 (Zymogen Granule Membrane) (GP2) antibody (ABIN635391) Glycoprotein 2 antibody used at 1 ug/ml to detect target protein.