GP2 Antikörper
-
- Target Alle GP2 Produkte
- GP2 (Glycoprotein 2 (Zymogen Granule Membrane) (GP2))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GP2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- Glycoprotein 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SLQAALQPIVSSLNVSVDGNGEFIVRMALFQDQNYTNPYEGDAVELSVES
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Glycoprotein 2 Blocking Peptide, catalog no. 33R-8616, is also available for use as a blocking control in assays to test for specificity of this Glycoprotein 2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GP2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GP2 (Glycoprotein 2 (Zymogen Granule Membrane) (GP2))
- Andere Bezeichnung
- Glycoprotein 2 (GP2 Produkte)
- Substanzklasse
- Viral Protein
- Hintergrund
- GP2 is component of pancreatic secretory (zymogen) granule. The exact function of GP2 remains unknown.
- Molekulargewicht
- 43 kDa (MW of target protein)
-