Telefon:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antikoerper-online.de

GP2 Antikörper (Glycoprotein 2 (Zymogen Granule Membrane)) Primary Antibody

GP2 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
Produktnummer ABIN635391
$647.32
Zzgl. Versandkosten $45.00
50 μg
local_shipping Lieferung nach: Vereinigte Staaten von Amerika
Lieferung in 9 bis 11 Werktagen
  • Target
    GP2
    Reaktivität
    Human
    • 78
    • 7
    • 4
    • 2
    • 2
    • 1
    Wirt
    Kaninchen
    Klonalität
    Polyklonal
    Konjugat
    Dieser GP2 Antikörper ist unkonjugiert
    • 33
    • 5
    • 5
    • 4
    • 4
    • 4
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    Applikation
    Western Blotting (WB)
    • 51
    • 48
    • 46
    • 46
    • 28
    • 22
    • 21
    • 8
    • 6
    • 3
    • 1
    • 1
    Aufreinigung
    Affinity purified
    Immunogen
    Glycoprotein 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SLQAALQPIVSSLNVSVDGNGEFIVRMALFQDQNYTNPYEGDAVELSVES
  • Applikationshinweise
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Kommentare

    Glycoprotein 2 Blocking Peptide, catalog no. 33R-8616, is also available for use as a blocking control in assays to test for specificity of this Glycoprotein 2 antibody

    Beschränkungen
    Nur für Forschungszwecke einsetzbar
  • Format
    Lyophilized
    Rekonstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GP2 antibody in PBS
    Konzentration
    Lot specific
    Buffer
    PBS
    Handhabung
    Avoid repeated freeze/thaw cycles.
    Lagerung
    4 °C
    Informationen zur Lagerung
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    GP2
    Andere Bezeichnung
    Glycoprotein 2 ()
    Synonyme
    ZAP75, 2310037I18Rik, AV060639, gp80, glycoprotein 2, glycoprotein 2 (zymogen granule membrane), GP2, Gp2
    Hintergrund
    GP2 is component of pancreatic secretory (zymogen) granule. The exact function of GP2 remains unknown.
    Molekulargewicht
    43 kDa (MW of target protein)
Sie sind hier:
help Kundenservice