GP2 Antikörper

Produktnummer ABIN635391

Produktdetails anti-GP2 Antikörper

Target: GP2 (Glycoprotein 2 (Zymogen Granule Membrane) (GP2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: Glycoprotein 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SLQAALQPIVSSLNVSVDGNGEFIVRMALFQDQNYTNPYEGDAVELSVES

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Glycoprotein 2 Blocking Peptide, catalog no. 33R-8616, is also available for use as a blocking control in assays to test for specificity of this Glycoprotein 2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GP2

Target: GP2 (Glycoprotein 2 (Zymogen Granule Membrane) (GP2))

Andere Bezeichnung: Glycoprotein 2 (GP2 Produkte)

Synonyme: ZAP75 antikoerper, 2310037I18Rik antikoerper, AV060639 antikoerper, gp80 antikoerper, glycoprotein 2 antikoerper, glycoprotein 2 (zymogen granule membrane) antikoerper, GP2 antikoerper, Gp2 antikoerper

Substanzklasse: Viral Protein

Hintergrund: GP2 is component of pancreatic secretory (zymogen) granule. The exact function of GP2 remains unknown.

Molekulargewicht: 43 kDa (MW of target protein)