Podoplanin Antikörper (PDPN) (Middle Region)

Details for Product anti-PDPN Antibody No. ABIN635390
Antigen
Epitop
Middle Region
25
22
16
10
9
9
4
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
Reaktivität
Human
191
46
18
5
1
Wirt
Kaninchen
119
80
12
11
7
4
2
Klonalität
Polyklonal
Konjugat
Dieser Podoplanin Antikörper ist unkonjugiert
15
10
6
4
4
4
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
176
96
68
54
49
37
34
27
9
3
2
2
2
1
1
1
1
Optionen
Immunogen Podoplanin antibody was raised using the middle region of PDPN corresponding to a region with amino acids VATSHSTEKVDGDTQTTVEKDGLSTVTLVGIIVGVLLAIGFIGAIIVVVM
Spezifität Podoplanin antibody was raised against the middle region of PDPN
Reinigung Affinity purified
Antigen
Andere Bezeichnung Podoplanin (PDPN Antibody Abstract)
Hintergrund PDPN is a type-I integral membrane glycoprotein with diverse distribution in human tissues. The physiological function of this protein may be related to its mucin-type character. The homologous protein in other species has been described as a differentiation antigen and influenza-virus receptor. The specific function of this protein has not been determined but it has been proposed as a marker of lung injury.
Molekulargewicht 25 kDa (MW of target protein)
Pathways Dicarboxylic Acid Transport
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

Podoplanin Blocking Peptide, catalog no. 33R-9441, is also available for use as a blocking control in assays to test for specificity of this Podoplanin antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDPN antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.