TMEM200B Antikörper (N-Term)

Produktnummer ABIN635385

Dieses Anti-TMEM200B-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von TMEM200B in WB. Geeignet für Human.

Kurzübersicht für TMEM200B Antikörper (N-Term) (ABIN635385)

Target: TMEM200B (Transmembrane Protein 200B (TMEM200B))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM200B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TMEM200B Antikörper

Bindungsspezifität: N-Term

Spezifität: TTMB antibody was raised against the N terminal Of Ttmb

Aufreinigung: Affinity purified

Immunogen: TTMB antibody was raised using the N terminal Of Ttmb corresponding to a region with amino acids AGYWPHRAGAPGSRAANASSPQMSELRREGRGGGRAHGPHERLRLLGPVI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TTMB Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this TTMB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TTMB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM200B

Target: TMEM200B (Transmembrane Protein 200B (TMEM200B))

Andere Bezeichnung: TTMB

Hintergrund: TTMB is a multi-pass membrane protein. It belongs to the TMEM200 family. The function of the TTMB protein remains unknown.

Molekulargewicht: 33 kDa (MW of target protein)