SLC35F3 Antikörper (Middle Region)

Produktnummer ABIN635380

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch SLC35F3 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für SLC35F3 Antikörper (Middle Region) (ABIN635380)

Target: SLC35F3 (Solute Carrier Family 35, Member F3 (SLC35F3))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC35F3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SLC35F3 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SLC35 F3 antibody was raised against the middle region of SLC35 3

Aufreinigung: Affinity purified

Immunogen: SLC35 F3 antibody was raised using the middle region of SLC35 3 corresponding to a region with amino acids LKVFFTKAAPFGVLWTLTNYLYLHAIKKINTTDVSVLFCCNKAFVFLLSW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC35F3 Blocking Peptide, (ABIN940497), is also available for use as a blocking control in assays to test for specificity of this SLC35F3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC35F3

Target: SLC35F3 (Solute Carrier Family 35, Member F3 (SLC35F3))

Andere Bezeichnung: SLC35F3

Hintergrund: SLC35F3 is a multi-pass membrane proteinPotential. It belongs to the SLC35F solute transporter family. SLC35F3 is a putative solute transporter.

Molekulargewicht: 55 kDa (MW of target protein)