Slc38a5 Antikörper (N-Term)

Produktnummer ABIN635377

Produktdetails anti-Slc38a5 Antikörper

Target: Slc38a5 (Solute Carrier Family 38, Member 5 (Slc38a5))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Slc38a5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SLC38 A5 antibody was raised against the N terminal of SLC38 5

Aufreinigung: Affinity purified

Immunogen: SLC38 A5 antibody was raised using the N terminal of SLC38 5 corresponding to a region with amino acids GIRAYEQLGQRAFGPAGKVVVATVICLHNVGAMSSYLFIIKSELPLVIGT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC38A5 Blocking Peptide, catalog no. 33R-3343, is also available for use as a blocking control in assays to test for specificity of this SLC38A5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Slc38a5

Target: Slc38a5 (Solute Carrier Family 38, Member 5 (Slc38a5))

Andere Bezeichnung: SLC38A5 (Slc38a5 Produkte)

Synonyme: MGC80848 antikoerper, slc38a3 antikoerper, SN2 antikoerper, JM24 antikoerper, SNAT5 antikoerper, pp7194 antikoerper, C81234 antikoerper, E330031E14 antikoerper, solute carrier family 38 member 5 S homeolog antikoerper, solute carrier family 38 member 5 antikoerper, solute carrier family 38, member 5 antikoerper, slc38a5.S antikoerper, SLC38A5 antikoerper, slc38a5 antikoerper, Slc38a5 antikoerper

Hintergrund: The protein encoded by this gene is a system N sodium-coupled amino acid transporter involved in the transfer of glutamine, asparagine, histidine, serine, alanine, and glycine.

Molekulargewicht: 51 kDa (MW of target protein)