SLC33A1 Antikörper

Produktnummer ABIN635371

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch SLC33A1 in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für SLC33A1 Antikörper (ABIN635371)

Target: SLC33A1 (Solute Carrier Family 33 Member 1 (SLC33A1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC33A1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SLC33A1 Antikörper

Aufreinigung: Affinity purified

Immunogen: SLC33 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids CNSVGQTAGYFLGNVLFLALESADFCNKYLRFQPQPRGIVTLSDFLFFWG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC33A1 Blocking Peptide, (ABIN937143), is also available for use as a blocking control in assays to test for specificity of this SLC33A1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC33A1

Target: SLC33A1 (Solute Carrier Family 33 Member 1 (SLC33A1))

Andere Bezeichnung: SLC33A1

Hintergrund: SLC33A1 is required for the formation of O-acetylated (Ac) gangliosides. It is predicted to contain 6 to 10 transmembrane domains, and a leucine zipper motif in transmembrane domain III. Studies indicate that the protein is localized to the cytoplasm.

Molekulargewicht: 61 kDa (MW of target protein)