SLC16A6 Antikörper
-
- Target Alle SLC16A6 Antikörper anzeigen
- SLC16A6 (Solute Carrier Family 16 (Monocarboxylic Acid Transporters), Member 6 (SLC16A6))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC16A6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SLC16 A6 antibody was raised using a synthetic peptide corresponding to a region with amino acids ILKEKSFICYALFGLFATLGFFAPSLYIIPLGISLGIDQDRAAFLLSTMA
- Top Product
- Discover our top product SLC16A6 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC16A6 Blocking Peptide, catalog no. 33R-4049, is also available for use as a blocking control in assays to test for specificity of this SLC16A6 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 6 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC16A6 (Solute Carrier Family 16 (Monocarboxylic Acid Transporters), Member 6 (SLC16A6))
- Andere Bezeichnung
- SLC16A6 (SLC16A6 Produkte)
- Synonyme
- MGC53009 antikoerper, solute carrier family 16 member 6 L homeolog antikoerper, solute carrier family 16 member 6 antikoerper, slc16a6.L antikoerper, SLC16A6 antikoerper
- Hintergrund
- SLC16A6 is a proton-linked monocarboxylate transporter.It catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate.
- Molekulargewicht
- 57 kDa (MW of target protein)
-