SLC37A4 Antikörper
-
- Target Alle SLC37A4 Antikörper anzeigen
- SLC37A4 (Solute Carrier Family 37 (Glucose-6-Phosphate Transporter), Member 4 (SLC37A4))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC37A4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SLC37 A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVEEIPLDKDDLGFITSSQSAAYAISKFVSGVLSDQMSARWLFSSGLLLV
- Top Product
- Discover our top product SLC37A4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC37A4 Blocking Peptide, catalog no. 33R-5506, is also available for use as a blocking control in assays to test for specificity of this SLC37A4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC37A4 (Solute Carrier Family 37 (Glucose-6-Phosphate Transporter), Member 4 (SLC37A4))
- Andere Bezeichnung
- SLC37A4 (SLC37A4 Produkte)
- Hintergrund
- SLC37A4 transports glucose-6-phosphate from the cytoplasm to the lumen of the endoplasmic reticulum. It forms with glucose-6-phosphatase the complex responsible for glucose production through glycogenolysis and gluconeogenesis. Hence, it plays a central role in homeostatic regulation of blood glucose levels.
- Molekulargewicht
- 46 kDa (MW of target protein)
- Pathways
- Carbohydrate Homeostasis, Cellular Glucan Metabolic Process
-