Solute Carrier Family 25 (Mitochondrial Carrier, Phosphate Carrier), Member 25 (SLC25A25) Antikörper

Details zu Produkt Nr. ABIN635361
Antigen
Reaktivität
Human
32
16
13
7
6
5
5
5
4
3
3
2
1
Wirt
Kaninchen
28
4
Klonalität
Polyklonal
Konjugat
Unkonjugiert
1
1
1
Applikation
Western Blotting (WB)
28
12
7
1
Optionen
Immunogen SLC25 A25 antibody was raised using a synthetic peptide corresponding to a region with amino acids MLQMLWHFLASFFPRAGCHGSREGDDREVRGTPAPAWRDQMASFLGKQDG
Reinigung Affinity purified
Antigen
Andere Bezeichnung SLC25A25 (SLC25A25 Antibody Abstract)
Hintergrund SLC25A25 is a calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. May act as a ATP-Mg/Pi exchanger that mediates the transport of Mg-ATP in exchange for phosphate, catalyzing the net uptake or efflux of adenine nucleotides into or from the mitochondria.
Molekulargewicht 55 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

SLC25A25 Blocking Peptide, catalog no. 33R-6204, is also available for use as a blocking control in assays to test for specificity of this SLC25A25 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 25 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Solute Carrier Family 25 (Mitochondrial Carrier, Phosphate Carrier), Member 25 (SLC25A25) antibody (ABIN635361) SLC25A25 antibody used at 1 ug/ml to detect target protein.