ABHD12 Antikörper (Abhydrolase Domain Containing 12) (Middle Region)

Details for Product anti-ABHD12 Antibody No. ABIN635357
Antigen
Epitop
Middle Region
11
9
9
4
3
3
1
1
1
Reaktivität
Human
54
26
25
4
4
4
4
3
2
1
1
1
1
Wirt
Kaninchen
45
7
3
Klonalität
Polyklonal
Konjugat
Dieser ABHD12 Antikörper ist unkonjugiert
4
3
3
3
3
3
1
1
1
1
1
1
Applikation
Western Blotting (WB)
46
37
12
6
6
1
1
Optionen
Immunogen ABHD12 antibody was raised using the middle region of ABHD12 corresponding to a region with amino acids CPLLILHAEDDPVVPFQLGRKLYSIAAPARSFRDFKVQFVPFHSDLGYRH
Spezifität ABHD12 antibody was raised against the middle region of ABHD12
Reinigung Affinity purified
Antigen
Andere Bezeichnung ABHD12 (ABHD12 Antibody Abstract)
Hintergrund ABHD12 may be a regulator of endocannabinoid signaling pathways.
Molekulargewicht 45 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

ABHD12 Blocking Peptide, catalog no. 33R-1766, is also available for use as a blocking control in assays to test for specificity of this ABHD12 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABHD12 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Abhydrolase Domain Containing 12 (ABHD12) (Middle Region) antibody (ABIN635357) ABHD12 antibody used at 1 ug/ml to detect target protein.