ABHD12 Antikörper (Middle Region)

Produktnummer ABIN635357

Der Kaninchen Polyklonal Anti-ABHD12-Antikörper wurde für WB validiert. Er ist geeignet, ABHD12 in Proben von Human zu detektieren.

Kurzübersicht für ABHD12 Antikörper (Middle Region) (ABIN635357)

Target: ABHD12 (Abhydrolase Domain Containing 12 (ABHD12))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ABHD12 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ABHD12 Antikörper

Bindungsspezifität: Middle Region

Spezifität: ABHD12 antibody was raised against the middle region of ABHD12

Aufreinigung: Affinity purified

Immunogen: ABHD12 antibody was raised using the middle region of ABHD12 corresponding to a region with amino acids CPLLILHAEDDPVVPFQLGRKLYSIAAPARSFRDFKVQFVPFHSDLGYRH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ABHD12 Blocking Peptide, catalog no. 33R-1766, is also available for use as a blocking control in assays to test for specificity of this ABHD12 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABHD12 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ABHD12

Target: ABHD12 (Abhydrolase Domain Containing 12 (ABHD12))

Andere Bezeichnung: ABHD12

Hintergrund: ABHD12 may be a regulator of endocannabinoid signaling pathways.

Molekulargewicht: 45 kDa (MW of target protein)