AWAT1 Antikörper (Acyl-CoA Wax Alcohol Acyltransferase 1) (N-Term)

Details for Product anti-AWAT1 Antibody No. ABIN635354
Antigen
Epitop
N-Term
6
3
3
2
2
1
1
1
Reaktivität
Human
30
7
5
3
3
2
2
2
2
1
1
Wirt
Kaninchen
27
3
Klonalität
Polyklonal
Konjugat
Dieser AWAT1 Antikörper ist unkonjugiert
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
25
12
1
1
1
1
Optionen
Immunogen AWAT1 antibody was raised using the N terminal of AWAT1 corresponding to a region with amino acids NWCVWTHIRDYFPITILKTKDLSPEHNYLMGVHPHGLLTFGAFCNFCTEA
Spezifität AWAT1 antibody was raised against the N terminal of AWAT1
Reinigung Affinity purified
Antigen
Andere Bezeichnung AWAT1 (AWAT1 Antibody Abstract)
Hintergrund The protein encoded by this gene belongs to the diacylglycerol acyltransferase family. It esterifies long chain (wax) alcohols with acyl-CoA-derived fatty acids to produce wax esters. Wax esters are enriched in sebum, suggesting that this enzyme plays a central role in lipid metabolism in skin. Consistent with this observation, this protein is predominantly expressed in the sebaceous gland of the skin.
Molekulargewicht 38 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

AWAT1 Blocking Peptide, catalog no. 33R-6931, is also available for use as a blocking control in assays to test for specificity of this AWAT1 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AWAT1 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Acyl-CoA Wax Alcohol Acyltransferase 1 (AWAT1) (N-Term) antibody (ABIN635354) AWAT1 antibody used at 1 ug/ml to detect target protein.