AWAT1 Antikörper (N-Term)

Produktnummer ABIN635354

Der Kaninchen Polyklonal Anti-AWAT1-Antikörper wurde für WB validiert. Er ist geeignet, AWAT1 in Proben von Human zu detektieren.

Kurzübersicht für AWAT1 Antikörper (N-Term) (ABIN635354)

Target: AWAT1 (Acyl-CoA Wax Alcohol Acyltransferase 1 (AWAT1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AWAT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-AWAT1 Antikörper

Bindungsspezifität: N-Term

Spezifität: AWAT1 antibody was raised against the N terminal of AWAT1

Aufreinigung: Affinity purified

Immunogen: AWAT1 antibody was raised using the N terminal of AWAT1 corresponding to a region with amino acids NWCVWTHIRDYFPITILKTKDLSPEHNYLMGVHPHGLLTFGAFCNFCTEA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AWAT1 Blocking Peptide, (ABIN5612251), is also available for use as a blocking control in assays to test for specificity of this AWAT1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AWAT1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AWAT1

Target: AWAT1 (Acyl-CoA Wax Alcohol Acyltransferase 1 (AWAT1))

Andere Bezeichnung: AWAT1

Hintergrund: The protein encoded by this gene belongs to the diacylglycerol acyltransferase family. It esterifies long chain (wax) alcohols with acyl-CoA-derived fatty acids to produce wax esters. Wax esters are enriched in sebum, suggesting that this enzyme plays a central role in lipid metabolism in skin. Consistent with this observation, this protein is predominantly expressed in the sebaceous gland of the skin.

Molekulargewicht: 38 kDa (MW of target protein)