OR2W5 Antikörper (Middle Region)
-
- Target Alle OR2W5 Antikörper anzeigen
- OR2W5 (Olfactory Receptor, Family 2, Subfamily W, Member 5 (OR2W5))
-
Bindungsspezifität
- Middle Region
- Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser OR2W5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- OR2 W5 antibody was raised against the middle region of OR2 5
- Aufreinigung
- Affinity purified
- Immunogen
- OR2 W5 antibody was raised using the middle region of OR2 5 corresponding to a region with amino acids SGEVPDSLLHHRHSQHQPPHLHFEEQGCEGDHEETSGVGERGWGASTRGT
- Top Product
- Discover our top product OR2W5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
OR2W5 Blocking Peptide, catalog no. 33R-8452, is also available for use as a blocking control in assays to test for specificity of this OR2W5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OR0 5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- OR2W5 (Olfactory Receptor, Family 2, Subfamily W, Member 5 (OR2W5))
- Andere Bezeichnung
- OR2W5 (OR2W5 Produkte)
- Synonyme
- OR2W5P antikoerper, OST722 antikoerper, olfactory receptor family 2 subfamily W member 5 (gene/pseudogene) antikoerper, OR2W5 antikoerper
- Hintergrund
- Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.
- Molekulargewicht
- 35 kDa (MW of target protein)
-