OR2W5 Antikörper (Olfactory Receptor, Family 2, Subfamily W, Member 5) (Middle Region)

Details for Product anti-OR2W5 Antibody No. ABIN635348
Antigen
Epitop
Middle Region
11
10
8
1
Reaktivität
Human
21
Wirt
Kaninchen
21
Klonalität
Polyklonal
Konjugat
Dieser OR2W5 Antikörper ist unkonjugiert
2
2
2
2
2
2
Applikation
Western Blotting (WB)
21
14
1
Optionen
Immunogen OR2 W5 antibody was raised using the middle region of OR2 5 corresponding to a region with amino acids SGEVPDSLLHHRHSQHQPPHLHFEEQGCEGDHEETSGVGERGWGASTRGT
Spezifität OR2 W5 antibody was raised against the middle region of OR2 5
Reinigung Affinity purified
Antigen
Andere Bezeichnung OR2W5 (OR2W5 Antibody Abstract)
Hintergrund Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.
Molekulargewicht 35 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

OR2W5 Blocking Peptide, catalog no. 33R-8452, is also available for use as a blocking control in assays to test for specificity of this OR2W5 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OR0 5 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Olfactory Receptor, Family 2, Subfamily W, Member 5 (OR2W5) (Middle Region) antibody (ABIN635348) OR2W5 antibody used at 1 ug/ml to detect target protein.