ENPP2 Antikörper (N-Term)
-
- Target Alle ENPP2 Antikörper anzeigen
- ENPP2 (Ectonucleotide Pyrophosphatase/phosphodiesterase 2 (ENPP2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ENPP2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ENPP2 antibody was raised against the N terminal of ENPP2
- Aufreinigung
- Affinity purified
- Immunogen
- ENPP2 antibody was raised using the N terminal of ENPP2 corresponding to a region with amino acids YTLATGLYPESHGIVGNSMYDPVFDATFHLRGREKFNHRWWGGQPLWITA
- Top Product
- Discover our top product ENPP2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ENPP2 Blocking Peptide, catalog no. 33R-10264, is also available for use as a blocking control in assays to test for specificity of this ENPP2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ENPP2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ENPP2 (Ectonucleotide Pyrophosphatase/phosphodiesterase 2 (ENPP2))
- Andere Bezeichnung
- ENPP2 (ENPP2 Produkte)
- Synonyme
- ATX antikoerper, ATX-X antikoerper, AUTOTAXIN antikoerper, LysoPLD antikoerper, NPP2 antikoerper, PD-IALPHA antikoerper, PDNP2 antikoerper, Npps2 antikoerper, PD-Ialpha antikoerper, Pdnp2 antikoerper, MGC132047 antikoerper, atx antikoerper, zgc:63550 antikoerper, autotaxin antikoerper, enpp2 antikoerper, enpp2a antikoerper, enpp2b antikoerper, ectonucleotide pyrophosphatase/phosphodiesterase 2 antikoerper, ectonucleotide pyrophosphatase/phosphodiesterase 2 L homeolog antikoerper, ectonucleotide pyrophosphatase/phosphodiesterase 2 S homeolog antikoerper, ENPP2 antikoerper, Enpp2 antikoerper, enpp2 antikoerper, enpp2.L antikoerper, enpp2.S antikoerper
- Hintergrund
- The protein encoded by this gene functions as both a phosphodiesterase, which cleaves phosphodiester bonds at the 5' end of oligonucleotides, and a phospholipase, which catalyzes production of lysophosphatidic acid (LPA) in extracellular fluids. LPA evokes growth factor-like responses including stimulation of cell proliferation and chemotaxis. This gene product stimulates the motility of tumor cells and has angiogenic properties, and its expression is upregulated in several kinds of carcinomas.
- Molekulargewicht
- 95 kDa (MW of target protein)
-