ENPP2 Antikörper (Ectonucleotide Pyrophosphatase/phosphodiesterase 2) (N-Term)

Details for Product anti-ENPP2 Antibody No. ABIN635340
Antigen
Epitop
N-Term
17
9
9
7
6
4
3
3
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
Reaktivität
Human
95
48
41
4
2
2
2
2
1
1
1
1
1
Wirt
Kaninchen
93
7
4
Klonalität
Polyklonal
Konjugat
Dieser ENPP2 Antikörper ist unkonjugiert
6
5
4
3
3
3
2
2
2
2
2
2
1
1
1
1
1
1
Applikation
Western Blotting (WB)
74
37
20
14
14
10
5
5
4
2
1
1
1
Optionen
Immunogen ENPP2 antibody was raised using the N terminal of ENPP2 corresponding to a region with amino acids YTLATGLYPESHGIVGNSMYDPVFDATFHLRGREKFNHRWWGGQPLWITA
Spezifität ENPP2 antibody was raised against the N terminal of ENPP2
Reinigung Affinity purified
Antigen
Andere Bezeichnung ENPP2 (ENPP2 Antibody Abstract)
Hintergrund The protein encoded by this gene functions as both a phosphodiesterase, which cleaves phosphodiester bonds at the 5' end of oligonucleotides, and a phospholipase, which catalyzes production of lysophosphatidic acid (LPA) in extracellular fluids. LPA evokes growth factor-like responses including stimulation of cell proliferation and chemotaxis. This gene product stimulates the motility of tumor cells and has angiogenic properties, and its expression is upregulated in several kinds of carcinomas.
Molekulargewicht 95 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

ENPP2 Blocking Peptide, catalog no. 33R-10264, is also available for use as a blocking control in assays to test for specificity of this ENPP2 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ENPP2 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Ectonucleotide Pyrophosphatase/phosphodiesterase 2 (ENPP2) (N-Term) antibody (ABIN635340) ENPP2 antibody used at 1 ug/ml to detect target protein.