MCART6 Antikörper (Middle Region)

Produktnummer ABIN635338

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch MCART6 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für MCART6 Antikörper (Middle Region) (ABIN635338)

Target: MCART6 (Mitochondrial Carrier Triple Repeat 6 (MCART6))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MCART6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MCART6 Antikörper

Bindungsspezifität: Middle Region

Spezifität: MCART6 antibody was raised against the middle region of MCART6

Aufreinigung: Affinity purified

Immunogen: MCART6 antibody was raised using the middle region of MCART6 corresponding to a region with amino acids WPVLARNSLGSALYFSFKDPIQDGLAEQGLPHWVPALVSGSVNGTITCLV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MCART6 Blocking Peptide, (ABIN5614693), is also available for use as a blocking control in assays to test for specificity of this MCART6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MCART6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MCART6

Target: MCART6 (Mitochondrial Carrier Triple Repeat 6 (MCART6))

Andere Bezeichnung: MCART6

Hintergrund: The function of MCART6 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 34 kDa (MW of target protein)