Solute Carrier Family 5 (Sodium/iodide Cotransporter), Member 5 (SLC5A5) Antikörper

Details zu Produkt Nr. ABIN635336
Antigen
Reaktivität
Human
131
107
100
4
2
2
Wirt
Kaninchen
103
34
Klonalität
Polyklonal
Konjugat
Unkonjugiert
5
4
4
4
4
4
4
4
4
4
4
4
4
4
4
4
4
2
2
2
2
2
2
1
1
1
1
1
1
Applikation
Western Blotting (WB)
125
112
48
34
28
19
13
8
4
2
1
1
Optionen
Immunogen SLC5 A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids TAVGGMKAVVWTDVFQVVVMLSGFWVVLARGVMLVGGPRQVLTLAQNHSR
Reinigung Affinity purified
Antigen
Andere Bezeichnung SLC5A5 (SLC5A5 Antibody Abstract)
Hintergrund The sodium-iodide symporter (NIS, or SLC5A5) is a key plasma membrane protein that mediates active I- uptake in thyroid, lactating breast, and other tissues with an electrogenic stoichiometry of 2 Na+ per I-. In thyroid, NIS-mediated I- uptake is the first step in the biosynthesis of iodine-containing thyroid hormones.
Molekulargewicht 69 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

SLC5A5 Blocking Peptide, catalog no. 33R-8989, is also available for use as a blocking control in assays to test for specificity of this SLC5A5 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 5 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Solute Carrier Family 5 (Sodium/iodide Cotransporter), Member 5 (SLC5A5) antibody (ABIN635336) SLC5A5 antibody used at 1 ug/ml to detect target protein.