SLC5A5 Antikörper
-
- Target Alle SLC5A5 Antikörper anzeigen
- SLC5A5 (Solute Carrier Family 5 (Sodium/iodide Cotransporter), Member 5 (SLC5A5))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC5A5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SLC5 A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids TAVGGMKAVVWTDVFQVVVMLSGFWVVLARGVMLVGGPRQVLTLAQNHSR
- Top Product
- Discover our top product SLC5A5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC5A5 Blocking Peptide, catalog no. 33R-8989, is also available for use as a blocking control in assays to test for specificity of this SLC5A5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC5A5 (Solute Carrier Family 5 (Sodium/iodide Cotransporter), Member 5 (SLC5A5))
- Andere Bezeichnung
- SLC5A5 (SLC5A5 Produkte)
- Synonyme
- Na(+)/I(-) cotransporter antikoerper, Na(+)/I(-) symporter antikoerper, Nis antikoerper, solute carrier family 5 member 5 antikoerper, Slc5a5 antikoerper
- Hintergrund
- The sodium-iodide symporter (NIS, or SLC5A5) is a key plasma membrane protein that mediates active I- uptake in thyroid, lactating breast, and other tissues with an electrogenic stoichiometry of 2 Na+ per I-. In thyroid, NIS-mediated I- uptake is the first step in the biosynthesis of iodine-containing thyroid hormones.
- Molekulargewicht
- 69 kDa (MW of target protein)
-