TM4SF20 Antikörper (Middle Region)

Produktnummer ABIN635333

Der Kaninchen Polyklonal Anti-TM4SF20-Antikörper wurde für WB validiert. Er ist geeignet, TM4SF20 in Proben von Human zu detektieren.

Kurzübersicht für TM4SF20 Antikörper (Middle Region) (ABIN635333)

Target: TM4SF20 (Transmembrane 4 L Six Family Member 20 (TM4SF20))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TM4SF20 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TM4SF20 Antikörper

Bindungsspezifität: Middle Region

Spezifität: TM4 SF20 antibody was raised against the middle region of TM4 F20

Aufreinigung: Affinity purified

Immunogen: TM4 SF20 antibody was raised using the middle region of TM4 F20 corresponding to a region with amino acids QALLKGPLMCNSPSNSNANCEFSLKNISDIHPESFNLQWFFNDSCAPPTG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TM4SF20 Blocking Peptide, (ABIN5616644), is also available for use as a blocking control in assays to test for specificity of this TM4SF20 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TM0 F20 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TM4SF20

Target: TM4SF20 (Transmembrane 4 L Six Family Member 20 (TM4SF20))

Andere Bezeichnung: TM4SF20

Hintergrund: TM4SF20 functions as a cellular component of the plasma membrane.

Molekulargewicht: 25 kDa (MW of target protein)