B4GALNT1 Antikörper (Middle Region)
-
- Target Alle B4GALNT1 Antikörper anzeigen
- B4GALNT1 (beta-1,4-N-Acetyl-Galactosaminyl Transferase 1 (B4GALNT1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser B4GALNT1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- B4 GALNT1 antibody was raised against the middle region of B4 ALNT1
- Aufreinigung
- Affinity purified
- Immunogen
- B4 GALNT1 antibody was raised using the middle region of B4 ALNT1 corresponding to a region with amino acids GLGSLRVGSCSDVVVDHASKLKLPWTSRDAGAETYARYRYPGSLDESQMA
- Top Product
- Discover our top product B4GALNT1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
B4GALNT1 Blocking Peptide, catalog no. 33R-3395, is also available for use as a blocking control in assays to test for specificity of this B4GALNT1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 ALNT1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- B4GALNT1 (beta-1,4-N-Acetyl-Galactosaminyl Transferase 1 (B4GALNT1))
- Andere Bezeichnung
- B4GALNT1 (B4GALNT1 Produkte)
- Hintergrund
- GM2 and GD2 gangliosides are sialic acid-containing glycosphingolipids. GalNAc-T is the enzyme involved in the biosynthesis of G(M2) and G(D2) glycosphingolipids. B4GALNT1(GalNAc-T) catalyzes the transfer of GalNAc into G(M3) and G(D3) by a beta-1,4 linkage, resulting in the synthesis of G(M2) and G(D2), respectively.
- Molekulargewicht
- 59 kDa (MW of target protein)
-