B4GALNT1 Antikörper (beta-1,4-N-Acetyl-Galactosaminyl Transferase 1) (Middle Region)

Details for Product anti-B4GALNT1 Antibody No. ABIN635329
Antigen
Epitop
Middle Region
13
9
9
7
4
4
3
2
1
1
1
1
1
Reaktivität
Human
57
24
15
5
4
4
4
4
2
2
Wirt
Kaninchen
52
5
Klonalität
Polyklonal
Konjugat
Dieser B4GALNT1 Antikörper ist unkonjugiert
3
2
2
2
2
2
1
1
1
1
1
1
Applikation
Western Blotting (WB)
50
31
4
2
1
1
1
1
Optionen
Immunogen B4 GALNT1 antibody was raised using the middle region of B4 ALNT1 corresponding to a region with amino acids GLGSLRVGSCSDVVVDHASKLKLPWTSRDAGAETYARYRYPGSLDESQMA
Spezifität B4 GALNT1 antibody was raised against the middle region of B4 ALNT1
Reinigung Affinity purified
Antigen
Andere Bezeichnung B4GALNT1 (B4GALNT1 Antibody Abstract)
Hintergrund GM2 and GD2 gangliosides are sialic acid-containing glycosphingolipids. GalNAc-T is the enzyme involved in the biosynthesis of G(M2) and G(D2) glycosphingolipids. B4GALNT1(GalNAc-T) catalyzes the transfer of GalNAc into G(M3) and G(D3) by a beta-1,4 linkage, resulting in the synthesis of G(M2) and G(D2), respectively.
Molekulargewicht 59 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

B4GALNT1 Blocking Peptide, catalog no. 33R-3395, is also available for use as a blocking control in assays to test for specificity of this B4GALNT1 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 ALNT1 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-beta-1,4-N-Acetyl-Galactosaminyl Transferase 1 (B4GALNT1) (Middle Region) antibody (ABIN635329) B4GALNT1 antibody used at 1 ug/ml to detect target protein.