Solute Carrier Family 35, Member E2 (SLC35E2) (Middle Region) Antikörper

Details zu Produkt Nr. ABIN635327
Antigen
Epitop
Middle Region
9
8
1
1
Reaktivität
Human
18
2
2
Wirt
Kaninchen
18
Klonalität
Polyklonal
Konjugat
Unkonjugiert
2
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
13
9
9
8
2
1
Optionen
Immunogen SLC35 E2 antibody was raised using the middle region of SLC35 2 corresponding to a region with amino acids AAASDRRSPVPPSERHGVRPHGENLPGDFQVPQALHRVALSMALPCPMLP
Spezifität SLC35 E2 antibody was raised against the middle region of SLC35 2
Reinigung Affinity purified
Antigen
Andere Bezeichnung SLC35E2 (SLC35E2 Antibody Abstract)
Hintergrund SLC35E2 is a putative transporter.
Molekulargewicht 29 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

SLC35E2 Blocking Peptide, catalog no. 33R-1007, is also available for use as a blocking control in assays to test for specificity of this SLC35E2 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 2 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Solute Carrier Family 35, Member E2 (SLC35E2) (Middle Region) antibody (ABIN635327) SLC35E2 antibody used at 1 ug/ml to detect target protein.