SLC35E2 Antikörper (Middle Region)
Kurzübersicht für SLC35E2 Antikörper (Middle Region) (ABIN635327)
Target
Alle SLC35E2 Antikörper anzeigenReaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Bindungsspezifität
- Middle Region
-
Spezifität
- SLC35 E2 antibody was raised against the middle region of SLC35 2
-
Aufreinigung
- Affinity purified
-
Immunogen
- SLC35 E2 antibody was raised using the middle region of SLC35 2 corresponding to a region with amino acids AAASDRRSPVPPSERHGVRPHGENLPGDFQVPQALHRVALSMALPCPMLP
-
-
-
-
Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
SLC35E2 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this SLC35E2 antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 2 antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- SLC35E2 (Solute Carrier Family 35, Member E2 (SLC35E2))
-
Andere Bezeichnung
- SLC35E2
-
Hintergrund
- SLC35E2 is a putative transporter.
-
Molekulargewicht
- 29 kDa (MW of target protein)
Target
-