SLC35E2 Antikörper (Middle Region)

Produktnummer ABIN635327

Der Kaninchen Polyklonal Anti-SLC35E2 Antikörper wurde für WB validiert. Er ist geeignet, SLC35E2 in Proben von Human zu detektieren.

Kurzübersicht für SLC35E2 Antikörper (Middle Region) (ABIN635327)

Target: SLC35E2 (Solute Carrier Family 35, Member E2 (SLC35E2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC35E2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SLC35E2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SLC35 E2 antibody was raised against the middle region of SLC35 2

Aufreinigung: Affinity purified

Immunogen: SLC35 E2 antibody was raised using the middle region of SLC35 2 corresponding to a region with amino acids AAASDRRSPVPPSERHGVRPHGENLPGDFQVPQALHRVALSMALPCPMLP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC35E2 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this SLC35E2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC35E2

Target: SLC35E2 (Solute Carrier Family 35, Member E2 (SLC35E2))

Andere Bezeichnung: SLC35E2

Hintergrund: SLC35E2 is a putative transporter.

Molekulargewicht: 29 kDa (MW of target protein)