SLC39A9 Antikörper

Produktnummer ABIN635326

Produktdetails anti-SLC39A9 Antikörper

Target: SLC39A9 (Solute Carrier Family 39 (Zinc Transporter), Member 9 (SLC39A9))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC39A9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: SLC39 A9 antibody was raised using a synthetic peptide corresponding to a region with amino acids YIGVSLVLGFVFMLLVDQIGNSHVHSTDDPEAARSSNSKITTTLGLVVHA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC39A9 Blocking Peptide, catalog no. 33R-10136, is also available for use as a blocking control in assays to test for specificity of this SLC39A9 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 9 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC39A9

Target: SLC39A9 (Solute Carrier Family 39 (Zinc Transporter), Member 9 (SLC39A9))

Andere Bezeichnung: SLC39A9 (SLC39A9 Produkte)

Synonyme: ZIP-9 antikoerper, ZIP9 antikoerper, 2010002A02Rik antikoerper, 2610511I23Rik antikoerper, 4833420E20Rik antikoerper, AW209151 antikoerper, slc39a9 antikoerper, MGC83699 antikoerper, MGC89410 antikoerper, wu:fc56g12 antikoerper, zgc:101628 antikoerper, DKFZp469D105 antikoerper, solute carrier family 39 member 9 antikoerper, solute carrier family 39, member 9 antikoerper, solute carrier family 39 (zinc transporter), member 9 antikoerper, solute carrier family 39 member 9 S homeolog antikoerper, solute carrier family 39 member 9 L homeolog antikoerper, SLC39A9 antikoerper, Slc39a9 antikoerper, slc39a9.S antikoerper, slc39a9.L antikoerper, slc39a9 antikoerper

Hintergrund: SLC39A9 may act as a zinc-influx transporter.

Molekulargewicht: 32 kDa (MW of target protein)