ACBD4 Antikörper (N-Term)

Produktnummer ABIN635315

Produktdetails anti-ACBD4 Antikörper

Target: ACBD4 (Acyl-CoA Binding Domain Containing 4 (ACBD4))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACBD4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ACBD4 antibody was raised against the N terminal of ACBD4

Aufreinigung: Affinity purified

Immunogen: ACBD4 antibody was raised using the N terminal of ACBD4 corresponding to a region with amino acids NSLGKMSREEAMSAYITEMKLVAQKVIDTVPLGEVAEDMFGYFEPLYQVI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACBD4 Blocking Peptide, catalog no. 33R-6881, is also available for use as a blocking control in assays to test for specificity of this ACBD4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACBD4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACBD4

Target: ACBD4 (Acyl-CoA Binding Domain Containing 4 (ACBD4))

Andere Bezeichnung: ACBD4 (ACBD4 Produkte)

Hintergrund: ACBD4 is a member of the acyl-coenzyme A binding domain containing protein family. All family members contain the conserved acyl-Coenzyme A binding domain, which binds acyl-CoA thiol esters. They are thought to play roles in acyl-CoA dependent lipid metabolism.

Molekulargewicht: 35 kDa (MW of target protein)