TCTA Antikörper (Middle Region)

Produktnummer ABIN635313

Der Kaninchen Polyklonal anti-TCTA Antikörper (ABIN635313) detektiert spezifisch TCTA in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für TCTA Antikörper (Middle Region) (ABIN635313)

Target: TCTA (T-Cell Leukemia Translocation Altered (TCTA))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TCTA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TCTA Antikörper

Bindungsspezifität: Middle Region

Spezifität: TCTA antibody was raised against the middle region of TCTA

Aufreinigung: Affinity purified

Immunogen: TCTA antibody was raised using the middle region of TCTA corresponding to a region with amino acids IQLAWGFYGNTVTGLYHRPGLGGQNGSTPDGSTHFPSWEMAANEPLKTHR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TCTA Blocking Peptide, (ABIN939500), is also available for use as a blocking control in assays to test for specificity of this TCTA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TCTA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TCTA

Target: TCTA (T-Cell Leukemia Translocation Altered (TCTA))

Andere Bezeichnung: TCTA

Hintergrund: A chromosomal aberration, translocation t(1,3)(p34,p21), involving TCTA is associated with T-cell acute lymphoblastic leukemia (T-ALL).

Molekulargewicht: 11 kDa (MW of target protein)