FAR2 Antikörper (C-Term)

Produktnummer ABIN635311

Produktdetails anti-FAR2 Antikörper

Target: FAR2 (Fatty Acyl CoA Reductase 2 (FAR2))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAR2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MLSTD1 antibody was raised against the C terminal Of Mlstd1

Aufreinigung: Affinity purified

Immunogen: MLSTD1 antibody was raised using the C terminal Of Mlstd1 corresponding to a region with amino acids WSTYNTEMLMSELSPEDQRVFNFDVRQLNWLEYIENYVLGVKKYLLKEDM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MLSTD1 Blocking Peptide, catalog no. 33R-10019, is also available for use as a blocking control in assays to test for specificity of this MLSTD1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MLSTD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAR2

Target: FAR2 (Fatty Acyl CoA Reductase 2 (FAR2))

Andere Bezeichnung: MLSTD1 (FAR2 Produkte)

Synonyme: MLSTD1 antikoerper, SDR10E2 antikoerper, A230046P18 antikoerper, AW048109 antikoerper, BC055759 antikoerper, Mlstd1 antikoerper, RGD1565966 antikoerper, FAR2 antikoerper, FATTY ACID REDUCTASE 2 antikoerper, MALE STERILITY 2 antikoerper, MALE STERILITY PROTEIN 2 antikoerper, MEC18.1 antikoerper, fatty acyl-CoA reductase 2 antikoerper, fatty acyl CoA reductase 2 antikoerper, Jojoba acyl CoA reductase-related male sterility protein antikoerper, FAR2 antikoerper, Far2 antikoerper, MS2 antikoerper

Hintergrund: MLSTD1 catalyzes the reduction of fatty acyl-CoA to fatty alcohols. The preferred substrates are C16, C18, C18:1 and C18:2 but low activity can be observed with C10-C14 substrates.

Molekulargewicht: 59 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom