FAR2 Antikörper (C-Term)

Produktnummer ABIN635311

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch FAR2 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für FAR2 Antikörper (C-Term) (ABIN635311)

Target: FAR2 (Fatty Acyl CoA Reductase 2 (FAR2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAR2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FAR2 Antikörper

Bindungsspezifität: C-Term

Spezifität: MLSTD1 antibody was raised against the C terminal Of Mlstd1

Aufreinigung: Affinity purified

Immunogen: MLSTD1 antibody was raised using the C terminal Of Mlstd1 corresponding to a region with amino acids WSTYNTEMLMSELSPEDQRVFNFDVRQLNWLEYIENYVLGVKKYLLKEDM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MLSTD1 Blocking Peptide, (ABIN935972), is also available for use as a blocking control in assays to test for specificity of this MLSTD1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MLSTD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAR2

Target: FAR2 (Fatty Acyl CoA Reductase 2 (FAR2))

Andere Bezeichnung: MLSTD1

Hintergrund: MLSTD1 catalyzes the reduction of fatty acyl-CoA to fatty alcohols. The preferred substrates are C16, C18, C18:1 and C18:2 but low activity can be observed with C10-C14 substrates.

Molekulargewicht: 59 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom