PGRMC1 Antikörper (N-Term)
-
- Target Alle PGRMC1 Antikörper anzeigen
- PGRMC1 (Progesterone Receptor Membrane Component 1 (PGRMC1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PGRMC1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- PGRMC1 antibody was raised against the N terminal of PGRMC1
- Aufreinigung
- Affinity purified
- Immunogen
- PGRMC1 antibody was raised using the N terminal of PGRMC1 corresponding to a region with amino acids MAAEDVVATGADPSDLESGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQ
- Top Product
- Discover our top product PGRMC1 Primärantikörper
-
anti-Progesterone Receptor Membrane Component 1 (PGRMC1) (AA 1-195) antibody
PGRMC1 Reaktivität: Human WB, IHC, ELISA, FACS, ICC Wirt: Maus Monoclonal 7G11G8 unconjugated
anti-Progesterone Receptor Membrane Component 1 (PGRMC1) (AA 44-195) antibodyPGRMC1 Reaktivität: Human WB, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Progesterone Receptor Membrane Component 1 (PGRMC1) (C-Term) antibodyVerified PGRMC1 Reaktivität: Human, Maus WB, IHC, ELISA, IF Wirt: Ziege Polyclonal unconjugated
anti-Progesterone Receptor Membrane Component 1 (PGRMC1) (C-Term) antibodyPGRMC1 Reaktivität: Human, Maus, Ratte WB, IHC, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Progesterone Receptor Membrane Component 1 (PGRMC1) (AA 96-195) antibodyPGRMC1 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 3F7 unconjugated
anti-Progesterone Receptor Membrane Component 1 (PGRMC1) (AA 67-102), (Middle Region) antibodyPGRMC1 Reaktivität: Human, Maus, Ratte WB, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Progesterone Receptor Membrane Component 1 (PGRMC1) (N-Term) antibodyPGRMC1 Reaktivität: Human, Kaninchen, Rind (Kuh), Hund, Pferd WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Progesterone Receptor Membrane Component 1 (PGRMC1) (C-Term) antibodyPGRMC1 Reaktivität: Human, Maus, Ratte, Kaninchen, Rind (Kuh), Hund, Pferd, Meerschweinchen, Zebrafisch (Danio rerio) WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Progesterone Receptor Membrane Component 1 (PGRMC1) (N-Term) antibodyPGRMC1 Reaktivität: Human, Maus, Ratte, Kaninchen, Rind (Kuh), Hund, Pferd, Schwein WB, IHC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PGRMC1 Blocking Peptide, catalog no. 33R-5590, is also available for use as a blocking control in assays to test for specificity of this PGRMC1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGRMC1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PGRMC1 (Progesterone Receptor Membrane Component 1 (PGRMC1))
- Andere Bezeichnung
- PGRMC1 (PGRMC1 Produkte)
- Synonyme
- MGC89150 antikoerper, wu:fa94d03 antikoerper, zgc:103577 antikoerper, DKFZp469D0815 antikoerper, HPR6.6 antikoerper, MPR antikoerper, AA415812 antikoerper, PPMR antikoerper, Vema antikoerper, 25-Dx antikoerper, 25Dx antikoerper, VEMA antikoerper, progesterone receptor membrane component 1 antikoerper, pgrmc1 antikoerper, PGRMC1 antikoerper, Pgrmc1 antikoerper
- Hintergrund
- Progesterone binding protein is a putative steroid membrane receptor. The protein is expressed predominantly in the liver and kidney.
- Molekulargewicht
- 22 kDa (MW of target protein)
-
