PGRMC1 Antikörper (N-Term)

Produktnummer ABIN635310

Dieses Anti-PGRMC1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von PGRMC1 in WB und IHC. Geeignet für Human.

Kurzübersicht für PGRMC1 Antikörper (N-Term) (ABIN635310)

Target: PGRMC1 (Progesterone Receptor Membrane Component 1 (PGRMC1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PGRMC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-PGRMC1 Antikörper

Bindungsspezifität: N-Term

Spezifität: PGRMC1 antibody was raised against the N terminal of PGRMC1

Aufreinigung: Affinity purified

Immunogen: PGRMC1 antibody was raised using the N terminal of PGRMC1 corresponding to a region with amino acids MAAEDVVATGADPSDLESGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQ

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PGRMC1 Blocking Peptide, (ABIN5615336), is also available for use as a blocking control in assays to test for specificity of this PGRMC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGRMC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PGRMC1

Target: PGRMC1 (Progesterone Receptor Membrane Component 1 (PGRMC1))

Andere Bezeichnung: PGRMC1

Hintergrund: Progesterone binding protein is a putative steroid membrane receptor. The protein is expressed predominantly in the liver and kidney.

Molekulargewicht: 22 kDa (MW of target protein)