MUC15 Antikörper (Middle Region)

Produktnummer ABIN635309

Der Kaninchen Polyklonal anti-MUC15 Antikörper wird verwendet zum Nachweis von MUC15 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für MUC15 Antikörper (Middle Region) (ABIN635309)

Target: MUC15 (Mucin 15, Cell Surface Associated (MUC15))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MUC15 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MUC15 Antikörper

Bindungsspezifität: Middle Region

Spezifität: MUC15 antibody was raised against the middle region of MUC15

Aufreinigung: Affinity purified

Immunogen: MUC15 antibody was raised using the middle region of MUC15 corresponding to a region with amino acids KFTNNSKLFPNTSDPQKENRNTGIVFGAILGAILGVSLLTLVGYLLCGKR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MUC15 Blocking Peptide, (ABIN939767), is also available for use as a blocking control in assays to test for specificity of this MUC15 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MUC15 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MUC15

Target: MUC15 (Mucin 15, Cell Surface Associated (MUC15))

Andere Bezeichnung: MUC15

Hintergrund: MUC15 may play a role in the cell adhesion to the extracellular matrix.

Molekulargewicht: 36 kDa (MW of target protein)