TMTC4 Antikörper (C-Term)

Produktnummer ABIN635307

Der Kaninchen Polyklonal anti-TMTC4 Antikörper (ABIN635307) detektiert spezifisch TMTC4 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Ratte und Maus.

Kurzübersicht für TMTC4 Antikörper (C-Term) (ABIN635307)

Target: TMTC4 (Transmembrane and Tetratricopeptide Repeat Containing 4 (TMTC4))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMTC4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TMTC4 Antikörper

Bindungsspezifität: C-Term

Spezifität: TMTC4 antibody was raised against the C terminal of TMTC4

Aufreinigung: Affinity purified

Immunogen: TMTC4 antibody was raised using the C terminal of TMTC4 corresponding to a region with amino acids NDHSLMFSLANVLGKSQKYKESEALFLKAIKANPNAASYHGNLAVLYHRW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMTC4 Blocking Peptide, (ABIN5616701), is also available for use as a blocking control in assays to test for specificity of this TMTC4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMTC4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMTC4

Target: TMTC4 (Transmembrane and Tetratricopeptide Repeat Containing 4 (TMTC4))

Andere Bezeichnung: TMTC4

Hintergrund: TMTC4 belongs to the TMTC family. Its exact function remains unknown.

Molekulargewicht: 83 kDa (MW of target protein)